|
|
||||||||

1 National Institute of Fruit Tree Science, Fujimoto, Tsukuba 305-8605, Japan
2 National Institute for Agro-Environmental Sciences, Kan-nondai, Tsukuba 305-8604, Japan
Correspondence
Chuan Zhao Wei
chenwei{at}vesta.ocn.ne.jp
| ABSTRACT |
|---|
|
|
|---|
The GenBank accession numbers of the sequences reported in this paper are AB098022 (segment 2) and AB098023 (segment 5).
Present address: National Agricultural Research Center for Kyushu Okinawa Region, Suya 2421, Nishigoshi, Kumamoto 861-1192, Japan. ![]()
| INTRODUCTION |
|---|
|
|
|---|
The 12 dsRNA species were designated segments (S) 112, on the basis of their electrophoretic mobility (Osaki et al., 2002
). Previous sequence analysis of the eight smaller segments has suggested that W370 dsRNA segments might have originated from a member of the virus family Reoviridae (Osaki et al., 2002
). In this paper we report the complete nucleotide sequences of W370 dsRNA genome segments 2 and 5. Double-shelled spherical particles of approximately 80 nm in diameter associated with W370 dsRNAs were observed in a preparation from the mycelial tissue of isolate W370. These results show that isolate W370 of R. necatrix harbours a novel reovirus member of the family Reoviridae. Since it has potential for use as a biocontrol agent of white root rot disease, we named it Rosellinia anti-rot virus (RArV).
| METHODS |
|---|
|
|
|---|
Extraction and purification of dsRNAs.
Total dsRNA was prepared as described by Morris & Dodds (1979)
, with minor modifications (Osaki et al., 2002
). The dsRNA was concentrated by ethanol precipitation and further purified using RNeasy Plant Mini Kits (Qiagen). The RNaid kit (BIO101) was used to isolate and purify dsRNA segments from polyacrylamide gels.
cDNA synthesis and cloning.
One cDNA library was synthesized, starting with 3 µg of purified total dsRNA. First-strand synthesis for the library was primed with 0·037 µg pd(N)6 random hexamer. A total volume of 20 µl containing primers and dsRNA mixture in water was denatured by boiling for 10 min. The TimeSaver cDNA synthesis kit (Amersham Pharmacia) was used for cDNA synthesis. Double-stranded cDNA was passed through a Sizesep 400 spun column to remove cDNA products with a length under 400 bp. The purified cDNA was ligated into the EcoRI site of pUC118, after addition of an EcoRI/NotI adaptor and transformed into Escherichia coli DH5
(Toyobo).
General recombinant DNA methods were as described in Sambrook et al. (1989)
. Recombinant plasmids were screened from ampicillin-resistant white colonies using the QIAprep Spin Miniprep Kit (Qiagen).
Nothern blotting.
Northern blot hybridization analysis was performed as described by Valverde et al. (1990)
, with minor modifications. Prior to electroblotting, dsRNA in polyacrylamide gels was denatured with 50 % (v/v) DMSO and 1 M glyoxal in 1x TBE at 50 °C for 1 h. Gels were electroblotted on to nylon membranes in the presence of 1x TBE at 100 mA for 2 h. Membranes were baked at 120 °C for 2 h and used for hybridization. Digoxigenin (Dig)-labelling and detection were carried out following the protocol of the DIG DNA labelling and detection kit (Boehringer Mannheim).
RT-PCR.
Plasmids containing cDNA inserts of 1·5 kb and longer were sequenced. PCR primers were designed from the terminal sequences of inserts and used for RT-PCR on isolated segments to confirm the identity of the template. RT-PCR was carried out using the RNA LA PCR kit (AMV) (Version 1.1) (TaKaRa) and 20 µM of each primer was used. Reverse transcription was carried out at 42 °C for 60 min. PCR amplification was carried out using 35 cycles of denaturation at 94 °C for 0·5 min, annealing at 45 °C for 0·5 min and extension at 72 °C for 3 min, with a final extension step at 72 °C for 7 min.
The distal ends of S2 and S5 were amplified by the 5' RACE (rapid amplification of cDNA ends) approach (Frohman, 1990
) using a 5' RACE kit (Invitrogen). Segments 2 and 5 isolated from polyacrylamide gels were used as template dsRNA. The RT-PCR products and 5' RACE products were cloned into the pCR2.1-TOPO vector using the TOPO TA cloning kit (Invitrogen).
Sequence analysis.
DNA sequences were analysed using GENETYX-WIN software (Software Development Co.). RNA secondary structures in both termini of the dsRNA segments were predicted using the program DNASIS Version 2.1 (Hitachi Software Engineering). Comparison of sequences with those available from nucleic acid and protein databases was performed using the NCBI BLAST 2.0 program (http://www3.ncbi.nlm.gov/BLAST). Multiple sequence alignment was performed using CLUSTAL W (Thompson et al., 1994
).
The Pfam program (http://www.sanger.ac.uk/Pfam/search.shtml) was used to search for previously described protein family domains. The Motif program (http://www.motif.genome.ad.jp) was used to analyse the theoretical protein sequences for the presence of known functional amino acid motifs.
Virus particle purification and electron microscopy.
Extraction of particle-containing fractions from the mycelia was performed with phosphate buffer (Kimura & Black, 1971
; Omura et al., 1982
), with minor modifications. W370 mycelia (100 g) were frozen in liquid nitrogen and ground to a fine powder. Potassium phosphate buffer (PB; 0·1 M, pH 7·2, 400 ml) was added to the ground mycelia. The mixture was stirred for 1 h, then passed through four layers of finely woven cotton cloth. Triton X-100 was added to a final concentration of 2 %. The mixture was stirred for 60 min, then centrifuged for 15 min at 3000 g. Polyethylene glycol 6000 and NaCl were added to the supernatant fluid to final concentrations of 6 % (w/v) and 0·3 M, respectively. The mixture was stirred for 40 min, then centrifuged for 15 min at 6000 g.
The resulting pellets were resuspended in 9 ml 0·1 M PB, pH 7·0. Carbon tetrachloride was added to a final concentration of 10 % and vortexed for 1 min. After centrifugation at 3000 g for 15 min, the supernatants were layered on to 1 ml sucrose cushions (20 % sucrose, w/v, in 0·1 M PB, pH 7·0) and centrifuged at 96 000 g for 2 h. The pellets were resuspended in 0·01 M PB, pH 7·0, containing 0·01 M MgCl2 (PB-Mg) (MgCl2 was added just before use) for 1 h and centrifuged for 15 min at 3000 g. The supernatant was layered on to 1040 % (w/v) linear sucrose gradients in PB-Mg and centrifuged for 80 min at 62 800 g in a Hitachi SRP-28SA1 rotor. Two bands, which corresponded to inner capsids and intact particles, respectively, were observed and collected separately. Appropriate fractions were centrifuged for 2 h at 96 000 g in a Hitachi RP-65T-320 rotor and the final pellets were resuspended in PB-Mg.
Particle preparations were stained with either 2 % phosphotungstic acid (PTA), pH 7·0, or 2 % aqueous uranyl acetate and then examined with a JEM-1200 EX electron microscope.
Isolate W380 and the isogenic dsRNA-free isolate from W370 were also treated in the same way.
| RESULTS |
|---|
|
|
|---|
|
Using the sequences of these RT-PCR products, the cDNA sequences of the entire dsRNA segments 2 and 5 could be completed, with the exception of the terminal sequences. The remainder of the S2 and S5 sequences was then determined by sequencing the 5' RACE products, using specific primers derived from the RT-PCR products or nested primers from the truncated 5' RACE products. The distal 3' end of S5 was determined according to the protocol for 5' RACE of GC-rich cDNA suggested by the manufacturer, since the dCTP-tailing method resulted in truncated products.
Sequences analysis of segments 2 and 5
The complete nucleotide sequences of S2 and S5 were 3773 and 2089 bases long, with GC contents of 50 % and 49·5 %, respectively. Sequence comparisons of the two segments with those available from nucleic acid databases showed no significant homology with reported virus sequences at the nucleotide level.
The extreme 5' and 3' ends of the sense strand of both segments had the sequence 5'-ACAAUUU...UGCAGAC-3'. The same terminal sequence has also been identified in eight other previously analysed segments (S4, S612) (Osaki et al., 2002
). Thus, as commonly found for members of the family Reoviridae, all segments were found to have conserved sequences located at the termini. Such conserved motifs are detected in many viruses possessing multisegmented genomes and have been suggested to play an important role in transcription, replication and packaging of RNA, as well as in virus maturation (Attoui et al., 1997
; Anzola et al., 1987
; Xu et al., 1989
). Segment-specific panhandle structures, formed by inverted terminal repeats, were found in the two segments (data not shown).
A single long open reading frame (ORF) was present in S2. The deduced polypeptide (designated VP2) contained 1226 amino acid residues (nt 633740) with a predicted molecular mass of about 138·5 kDa. A single long ORF was also present in S5. The deduced polypeptide (designated VP5) contained 646 amino acid residues (nt 461983) with a predicted molecular mass of about 72 kDa.
The BLAST 2.0 program was used to search for protein sequence homologies. The deduced VP2 protein sequence showed homology with the putative VP2 of Colorado tick fever virus (CTFV; 23 % identity, 39 % similarity) and the putative VP2 of European Eyach virus (EYAV; 24 % identity, 39 % similarity) (Attoui et al., 2000
, 2002
). Analysis of amino acid sequences using the NCBI BLAST program showed that the deduced VP5 protein sequence had no similarity to other viral proteins.
A search for functional motifs in the deduced protein sequences encoded by the ORFs of S2 and S5 was conducted. The VP2 sequence was found to contain a methyltransferase family motif (LATKIAFLMNPLAYERNRHVKAAVLFDFIR) at aa 510539, which is also conserved in VP2 of CTFV and EYAV (Fig. 2
). Therefore, these putative proteins are proposed to act as methyltransferases (Attoui et al., 2000
, 2002
). No known functional amino acid motifs or previously described protein domains were found in the sequence of S5 using either the Motif or the Pfam programs.
|
|
| DISCUSSION |
|---|
|
|
|---|
Previous sequence analysis of the eight smaller segments (S4, S612) suggested that W370 dsRNA segments might have originated from a member of the family Reoviridae. Conserved terminal sequences at both 5' and 3' ends were found in all eight segments and the deduced amino acid sequences of W370 dsRNAs showed partial similarities to several proteins of viruses in the family Reoviridae (Osaki et al., 2002
.). Combined with the results of the sequence analysis of these eight smaller segments, the lack of any significant homology in the majority of gene products supports the suggestion that W370 dsRNAs represent a virus from a member of a distinct new genus of the family Reoviridae (Mertens et al., 2000
). However, the sequences of segments 1 and 3 have yet to be determined.
Hypovirulent isolate W370 contained RArV particles associated with 12 dsRNA segments, but the same particles were not found in an isogenic dsRNA-free isolate from W370 obtained by hyphal tip isolation. Similarly, viral particles and dsRNAs were not detected from a healthy isolate, W380, of R. necatrix; these results suggest that RArV acts as a hypovirulence factor to the host R. necatrix. We may thus be able to use the virus to attenuate fungal virulence to control white root rot by transfection of the virus into the virulent host R. necatrix directly or by as yet unidentified potential vectors.
| ACKNOWLEDGEMENTS |
|---|
| REFERENCES |
|---|
|
|
|---|
Arakawa, M., Nakamura, H., Uetake, Y., Nitta, H., Naganawa, T., Kakishima, M., Okabe, I. & Matsumoto, N. (2001). Double-stranded RNA in the white root rot fungus, Rosellinia necatrix, as a hypovirulence factor. Jpn J Phytopathol 67, 192.
Arakawa, M., Nakamura, H., Uetake, Y. & Matsumoto, N. (2002). Presence and distribution of double-stranded RNA elements in the white root rot fungus, Rosellinia necatrix. Mycoscience 43, 2126.[CrossRef]
Attoui, H., Micco, P. & de Lamballerie, X. (1997). Complete nucleotide sequence of Colorado tick fever virus segments M6, S1 and S2. J Gen Virol 78, 28952899.[Abstract]
Attoui, H., Billoir, F., Biagini, P., Cantaloube, J. F., de Chesse, R., de Micco, P. & de Lamballerie, X. (2000). Sequence determination and analysis of the full-length genome of Colorado tick fever virus, the type species of genus Coltivirus (family Reoviridae). Biochem Biophys Res Commun 273, 11211125.[CrossRef][Medline]
Attoui, H., Mohd Jaafar, F., Biagini, P., Cantaloube, J.-F., de Micco, P., Murphy, F. A. & de Lamballerie, X. (2002). Genus Coltivirus (family Reoviridae): genomic and morphologic characterization of Old World and New World viruses. Arch Virol 147, 533561.[CrossRef][Medline]
Enebak, S. A., Hillman, B. I. & MacDonald, W. L. (1994). A hypovirulent isolate of Cryphonectria parasitica with multiple, genetically unique dsRNA segments. Mol Plant Microbe Interact 5, 590595.
Frohman, M. A. (1990). RACE: rapid amplification of cDNA ends. In PCR Protocols: a Guide to Methods and Applications, pp. 2838. Edited by M. A. Innis, D. H.Gelfand, J. J. Sninsky & T. J. White. San Diego: Academic Press.
Kimura, I. & Black, L. M. (1971). Some factors affecting infectivity assays of wound-tumor virus on cell monolayers from an insect vector. Virology 46, 266276.[CrossRef][Medline]
Mertens, P. P. C., Arella, M., Attoui, H. & 41 others (2000). Family Reoviridae. In Virus Taxonomy. Seventh Report of the International Committee on Taxonomy of Viruses, pp. 395480. Edited by M. H. V. van Regenmortel, C. M. Fauquet, D. H. L. Bishop, E. B. Carstens, M. K. Estes, S. M. Lemon, J. Maniloff, M. A. Mayo, D. J. McGeoch, C. R. Pringle & R. B. Wickner. San Diego: Academic Press.
Milne, R. G. & Lovisolo, O. (1977). Maize rough dwarf and related viruses. Adv Virus Res 21, 267341.[Medline]
Morris, T. J. & Dodds, J. A. (1979). Isolation and analysis of double-stranded RNA from virus-infected plant and fungal tissue. Phytopathology 69, 854858.
Omura, T., Morinaka, T., Inoue, H. & Saito, Y. (1982). Purification and some properties of rice gall dwarf virus, a new phytoreovirus. Phytopathology 72, 12461249.
Osaki, H., Wei, C. Z., Arakawa, M., Iwanami, T., Nomura, K., Matsumoto, N. & Ohtsu, Y. (2002). Nucleotide sequences of double-stranded RNA segments from a hypovirulent strain of the white root rot fungus Rosellinia necatrix: possibility of the first member of the Reoviridae from fungus. Virus Genes 25, 101107.[CrossRef][Medline]
Sambrook, J., Fritsch, E. F. & Maniatis, T. (1989). Molecular Cloning: a Laboratory Manual, 2nd edn. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory.
Sztejnberg, A. (1994). Rosellinia (Dematophora) root rot. In Compendium of Tropical Fruit Diseases, pp. 8081. Edited by R. C. Ploetz, G. A. Zentmyer, W. T. Nishijima, K. G. Rohrbach & H. D. Ohr. St Paul, MN: APS Press.
Thompson, J. D., Higgins, D. G. & Gibson, T. J. (1994). CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res 22, 46734680.
Valverde, R. A., Nameth, S., Abdallha, O., Al-Musa, O., Desjardins, P. & Dodds, A. (1990). Indigenous double-stranded RNA from pepper (Capsicum annuum). Plant Science 67, 195201.[CrossRef]
Xu, Z., Anzola, J. V., Nalin, C. M. & Nuss, D. L. (1989). The 3'-terminal sequence of wound tumor virus transcripts can influence conformational and functional properties associated with the 5' terminus. Virology 170, 511522.[CrossRef][Medline]
Received 15 January 2003;
accepted 7 May 2003.
This article has been cited by other articles:
![]() |
N. Suzuki, S. Supyani, K. Maruyama, and B. I. Hillman Complete genome sequence of Mycoreovirus-1/Cp9B21, a member of a novel genus within the family Reoviridae, isolated from the chestnut blight fungus Cryphonectria parasitica J. Gen. Virol., November 1, 2004; 85(11): 3437 - 3448. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Jiang and S. A. Ghabrial Molecular characterization of Penicillium chrysogenum virus: reconsideration of the taxonomy of the genus Chrysovirus J. Gen. Virol., July 1, 2004; 85(7): 2111 - 2121. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. L. Nibert and J. Kim Conserved Sequence Motifs for Nucleoside Triphosphate Binding Unique to Turreted Reoviridae Members and Coltiviruses J. Virol., May 15, 2004; 78(10): 5528 - 5530. [Full Text] [PDF] |
||||
![]() |
B. I. Hillman, S. Supyani, H. Kondo, and N. Suzuki A Reovirus of the Fungus Cryphonectria parasitica That Is Infectious as Particles and Related to the Coltivirus Genus of Animal Pathogens J. Virol., January 15, 2004; 78(2): 892 - 898. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| INT J SYST EVOL MICROBIOL | MICROBIOLOGY | J GEN VIROL |
| J MED MICROBIOL | ALL SGM JOURNALS | |