|
|
||||||||
Short Communication |
Macfarlane Burnet Institute for Medical Research and Public Health Ltd, GPO Box 2284, Melbourne 3001, Australia
Correspondence
Heidi E. Drummer
hdrummer{at}burnet.edu.au
| ABSTRACT |
|---|
|
|
|---|
| MAIN TEXT |
|---|
|
|
|---|
X-ray crystallography has thus far revealed two structural classes of fusion glycoprotein (Kielian, 2006
; Kielian & Rey, 2006
; Skehel & Wiley, 2000
; Stiasny & Heinz, 2006
). Class I fusion proteins [e.g. human immunodeficiency virus 1 (HIV-1) gp41, influenza virus HA2] are helical, trimeric rods that project as spikes from the viral envelope. In the fusion-activated state, their N (fusion peptide-proximal) and C (TMD-proximal) termini become juxtaposed at one end of a helical hairpin core domain. Class II fusion glycoproteins (e.g. flavivirus E, alpha virus E1) comprise three domains rich in
-strands that lie roughly parallel to the viral membrane. At neutral pH, the metastable state of E, which has dual receptor-binding and fusion functions, is maintained in a homodimer by monomermonomer interactions that sequester the fusion loop. In the case of alphaviruses, glycoprotein E2 mediates receptor binding, whereas the associated E1 trimer mediates fusion. E1 metastability is maintained through E1E2 interactions. At low fusion pH, E and E1 have almost identical trimeric structures where membrane-inserted fusion loops are atop three uptilted protomers. Trimerization creates three surface-exposed hydrophobic grooves along the trimer axis for the antiparallel packing of the TMD-proximal amphipathic
-helical stem to form a hairpin. Thus, hairpin formation is employed by both classes of fusion glycoprotein to appose membrane-associated fusion peptides and TMDs, which leads to membrane fusion.
Hepatitis C virus (HCV), a member of the family Flaviviridae, is distantly related to flaviviruses and encodes two type 1 transmembrane glycoproteins, E1 (polyprotein residues 191383) and E2 (384746), which are cleaved from the viral polyprotein precursor by signal peptidases in the endoplasmic reticulum (ER). Entry of HCV occurs via clathrin-dependent receptor-mediated endocytosis, with the low pH environment of the endosome triggering membrane fusion (Blanchard et al., 2006
; Codran et al., 2006
; Lavillette et al., 2006
; Tscherne et al., 2006
). E1 and E2 mediate viral entry as a non-covalently associated heterodimer (Drummer et al., 2003
); however, the mechanism whereby these glycoproteins mediate membrane fusion is not understood.
Several lines of investigation suggest that E2 functions as a class II fusion glycoprotein. For example, as for flaviviral E, E2 comprises a large ectodomain (residues 384661) that can be divided further into three subdomains based on cross-competition studies with conformation-dependent mAbs (Keck et al., 2004
, 2005
). By using molecular modelling approaches, Yagnik et al. (2000)
proposed that E2 is a homologue of flaviviral glycoprotein E with receptor-binding, dimerization and fusion domains. Furthermore, we have shown that a membrane-proximal heptad repeat (residues 675699) within the approximately 55-residue sequence linking the E2 ectodomain to the TMD is important for E1E2 heterodimerization and viral entry (Drummer & Poumbourios, 2004
). This observation led us to propose that the membrane-proximal heptad repeat of E2 is analogous to the stem of flavivirus glycoprotein E (Drummer & Poumbourios, 2004
). If E2 functions as a class II fusion protein, then it should also possess an internal fusion peptide. Recently, we examined a conserved class II fusion peptide-like sequence, C429NESLNTGWLAGLFYQHKFNSSGC452, located within the N-terminal portion of E2. Interestingly, even though this sequence has all the hallmarks of a class II fusion peptide (Delos et al., 2000
), our analysis indicated that it functions as a CD81-binding site (Drummer et al., 2006
). Thus, the role of E2 in membrane fusion remains unknown.
An alternative hypothesis is that E1 represents a truncated class II fusion glycoprotein that has lost receptor-binding function during its evolution (Garry & Dash, 2003
). Based on this model, it was suggested that the conserved hydrophobic E1 sequence C272SALYVGDLC281 is a truncated class II fusion peptide. However, the region does not have strong homology to the class II fusion peptides of flavivirus glycoprotein E, e.g. Tick-borne encephalitis virus (TBEV) (CKRDQSDRGWGNHCGLFGKGSIVAC), or alphavirus E1, e.g. Semliki Forest virus (CKVYTGVYPFMWGGAYCFCDSENTQ), underlined sequences representing the exposed fusion loop. However, C-terminal extension of the predicted HCV E1 fusion peptide, C272SALYVGDLCGSVFLVGQLFTFSPRRHWTTQDC, incorporates class II fusion peptide elements such as the VFLVG motif (underlined) and a total of three conserved cysteine residues (bold). In addition, the region contains a central proline residue believed to be a feature of internal fusion peptides (Delos et al., 2000
). Further analysis of E1 ectodomain sequences revealed a second truncated class II fusion glycoprotein motif: a conserved three hydrophobic-heptad repeat, A330ALVVAQLLRIPQAIMDM347, preceding the TMD (Fig. 1
).
|
Previous studies with the prototypical class II fusion protein, glycoprotein E of TBEV, revealed that mutations in the fusion peptide disrupted native glycoprotein structure due to the ablation of monomermonomer contacts, while mutations in the stem region affected heterodimerization between the viral glycoproteins prM and E, and the conversion of E dimers to trimers at the low pH of fusion (Allison et al., 1999
, 2001
; Rey et al., 1995
). We therefore examined whether the E1 mutations altered the ability of E1 and E2 to be processed from the polyprotein, to form non-covalent heterodimers and to become incorporated into retroviral pseudotyped particles. The pseudotyping of HIV-1 with mature forms of E1E2 (E1E2-pp) confers infectivity for primary human hepatocytes and various human liver cell lines including Huh7 (Bartosch et al., 2003
; Drummer et al., 2003
; Hsu et al., 2003
). These E1E2-pps have been validated as a surrogate model to study HCV entry (Bartosch & Cosset, 2006
; Lindenbach et al., 2005
). E1E2-pps were produced by co-transfecting 293T cells with pH77E1E2 and pNL43.LUC.RE (from N. Landau, NIH AIDS Reagent Bank, Germantown, MD, USA; He & Landau, 1995
) as described previously (Drummer & Poumbourios, 2004
). The E1E2-pps were labelled with 75 µCi Trans 35S-label for 18 h, and then pelleted from filtered (0.45 µm) culture supernatants at 23 000 g for 2 h. Immunoprecipitation of viral lysates with the conformation-dependent anti-E2 mAb, H53, and non-reducing SDS-PAGE indicated that similar amounts of non-covalently associated E1 and E2 were incorporated into E1E2-pps for the wild-type and mutated glycoproteins (Fig. 2a
). Notably, substitution of the a and d position heptad-repeat residues with proline, which can induce kinks of up to 3 ° in coiled coils (Chang et al., 1999
), did not alter the overall level of glycoprotein expression and/or heterodimerization between E1 and E2. Immunoprecipitation with polyclonal IgG obtained from an HIV-infected individual (IgG14) was used to confirm that similar amounts of HIV-1 structural protein were present in the E1E2-pps (Fig. 2b
). The results indicate that the mutants were efficiently processed from the polyprotein, forming non-covalently associated E1E2 heterodimers that could be incorporated into E1E2-pps.
|
We next examined the effect of these mutations on viral entry. E1E2-pps produced in 293T cells were used to infect Huh7 cells for 4 h. After removal of the inoculum, the cells were cultured for 3 days prior to assay with the Promega luciferase substrate system in a Fluostar microplate reader (BMG LabTechnologies) (Drummer & Poumbourios, 2004
). The V277A and L286A fusion peptide motif mutants exhibited wild-type levels of entry, while the entry competence of Y276A and Y276R mutations was not significantly different from V277A and L286A entry levels. However, the F285A mutation was not tolerated, suggesting that this amino acid plays a critical role in the entry process (Fig. 3a
). Mutagenesis of the a and d positions of the membrane-proximal heptad repeat to proline completely blocked viral entry while mutation to the helix-forming residue, alanine, resulted in site-specific entry defects (Fig. 3b
). Significant reductions in entry were observed for V333A, L337A and M347A (P < 0.05), while I340A and I344A did not significantly alter viral entry competence (P > 0.05) (Fig. 3b
). None of these defects in viral entry were associated with a loss of CD81 receptor-binding ability (Fig. 2c, d
), suggesting that these mutations in E1 affect a non-CD81-dependent stage of viral entry.
|
The stem region of flavivirus glycoprotein E is required for heterodimerization with prM in the metastable prefusion complex, the conversion of E dimers into homotrimers at low pH and the stability of the trimer of hairpins (Bressanelli et al., 2004
; Allison et al., 1999
; Modis et al., 2004
). Proline mutagenesis of the a and d residues of the short membrane-proximal heptad repeat of E1 (A330ALVVAQLLRIPQAIMDM) had no effect on heterodimerization, while Ala substitutions resulted in site-specific defects in viral entry (V333A, L337A and M347A), again with no effect on heterodimerization. By contrast, an earlier study found that Ala- and Pro-substitution mutagenesis of the membrane-proximal heptad repeat of E2 (675699) resulted in loss of heterodimerization with E1 and loss of viral entry function. Thus, the E2 heptad-repeat region has features consistent with its function as a class II fusion protein stem region (Drummer & Poumbourios, 2004
). A fusion peptide has thus far not been defined for E2. A synthetic peptide (residues 430449) encompassing a candidate fusion peptide motif, G436WLAGLFY, was shown to mediate liposome fusion (Pacheco et al., 2006
). However, mutagenic analysis of the motif in the context of E1E2 revealed that it was essential for CD81 binding (Drummer et al., 2006
). Receptor disengagement following internalization and trafficking to the late endosome would be required for this sequence to function as a fusion peptide. An alternative mechanism of E1E2-mediated fusion could involve E1 and E2 acting cooperatively through the contribution of the fusion loop by E1 and the stem by E2, potentially representing a new paradigm for viral fusion.
| ACKNOWLEDGEMENTS |
|---|
| REFERENCES |
|---|
|
|
|---|
Allison, S. L., Schalich, J., Stiasny, K., Mandl, C. W. & Heinz, F. X. (2001). Mutational evidence for an internal fusion peptide in flavivirus envelope protein E. J Virol 75, 42684275.
Bartosch, B. & Cosset, F. L. (2006). Cell entry of hepatitis C virus. Virology 348, 112.[CrossRef][Medline]
Bartosch, B., Dubuisson, J. & Cosset, F. L. (2003). Infectious hepatitis C virus pseudo-particles containing functional E1E2 envelope protein complexes. J Exp Med 197, 633642.
Blanchard, E., Belouzard, S., Goueslain, L., Wakita, T., Dubuisson, J., Wychowski, C. & Rouille, Y. (2006). Hepatitis C virus entry depends on clathrin-mediated endocytosis. J Virol 80, 69646972.
Bressanelli, S., Stiasny, K., Allison, S. L., Stura, E. A., Duquerroy, S., Lescar, J., Heinz, F. X. & Rey, F. A. (2004). Structure of a flavivirus envelope glycoprotein in its low-pH-induced membrane fusion conformation. EMBO J 23, 728738.[CrossRef][Medline]
Chang, D. K., Cheng, S. F., Trivedi, V. D. & Lin, K. L. (1999). Proline affects oligomerization of a coiled coil by inducing a kink in a long helix. J Struct Biol 128, 270279.[CrossRef][Medline]
Codran, A., Royer, C., Jaeck, D., Bastien-Valle, M., Baumert, T. F., Kieny, M. P., Pereira, C. A. & Martin, J. P. (2006). Entry of hepatitis C virus pseudotypes into primary human hepatocytes by clathrin-dependent endocytosis. J Gen Virol 87, 25832593.
Delos, S. E., Gilbert, J. M. & White, J. M. (2000). The central proline of an internal viral fusion peptide serves two important roles. J Virol 74, 16861693.
Drummer, H. E. & Poumbourios, P. (2004). Hepatitis C virus glycoprotein E2 contains a membrane-proximal heptad repeat sequence that is essential for E1E2 glycoprotein heterodimerization and viral entry. J Biol Chem 279, 3006630072.
Drummer, H. E., Wilson, K. A. & Poumbourios, P. (2002). Identification of the hepatitis C virus e2 glycoprotein binding site on the large extracellular loop of CD81. J Virol 76, 1114311147.
Drummer, H. E., Maerz, A. & Poumbourios, P. (2003). Cell surface expression of functional hepatitis C virus E1 and E2 glycoproteins. FEBS Lett 546, 385390.[CrossRef][Medline]
Drummer, H. E., Boo, I., Maerz, A. L. & Poumbourios, P. (2006). A conserved Gly436-Trp-Leu-Ala-Gly-Leu-Phe-Tyr motif in hepatitis C virus glycoprotein e2 is a determinant of CD81 binding and viral entry. J Virol 80, 78447853.
Garry, R. F. & Dash, S. (2003). Proteomics computational analyses suggest that hepatitis C virus E1 and pestivirus E2 envelope glycoproteins are truncated class II fusion proteins. Virology 307, 255265.[CrossRef][Medline]
He, J. & Landau, N. R. (1995). Use of a novel human immunodeficiency virus type 1 reporter virus expressing human placental alkaline phosphatase to detect an alternative viral receptor. J Virol 69, 45874592.[Abstract]
Hsu, M., Zhang, J., Flint, M., Logvinoff, C., Cheng-Mayer, C., Rice, C. M. & McKeating, J. A. (2003). Hepatitis C virus glycoproteins mediate pH-dependent cell entry of pseudotyped retroviral particles. Proc Natl Acad Sci U S A 100, 72717276.
Keck, Z. Y., Op De Beeck, A., Hadlock, K. G., Xia, J., Li, T. K., Dubuisson, J. & Foung, S. K. (2004). Hepatitis C virus e2 has three immunogenic domains containing conformational epitopes with distinct properties and biological functions. J Virol 78, 92249232.
Keck, Z. Y., Li, T. K., Xia, J., Bartosch, B., Cosset, F. L., Dubuisson, J. & Foung, S. K. (2005). Analysis of a highly flexible conformational immunogenic domain a in hepatitis C virus E2. J Virol 79, 1319913208.
Kielian, M. (2006). Class II virus membrane fusion proteins. Virology 344, 3847.[CrossRef][Medline]
Kielian, M. & Rey, F. A. (2006). Virus membrane-fusion proteins: more than one way to make a hairpin. Nat Rev Microbiol 4, 6776.[CrossRef][Medline]
Lavillette, D., Bartosch, B., Nourrisson, D., Verney, G., Cosset, F. L., Penin, F. & Pecheur, E. I. (2006). Hepatitis C virus glycoproteins mediate low pH-dependent membrane fusion with liposomes. J Biol Chem 281, 39093917.
Lindenbach, B. D., Evans, M. J., Syder, A. J., Wolk, B., Tellinghuisen, T. L., Liu, C. C., Maruyama, T., Hynes, R. O., Burton, D. R. & other authors (2005). Complete replication of hepatitis C virus in cell culture. Science 309, 623626.
Modis, Y., Ogata, S., Clements, D. & Harrison, S. C. (2004). Structure of the dengue virus envelope protein after membrane fusion. Nature 427, 313319.[CrossRef][Medline]
Owsianka, A. M., Timms, J. M., Tarr, A. W., Brown, R. J., Hickling, T. P., Szwejk, A., Bienkowska-Szewczyk, K., Thomson, B. J., Patel, A. H. & Ball, J. K. (2006). Identification of conserved residues in the e2 envelope glycoprotein of the hepatitis C virus that are critical for CD81 binding. J Virol 80, 86958704.
Pacheco, B., Gomez-Gutierrez, J., Yelamos, B., Delgado, C., Roncal, F., Albar, J. P., Peterson, D. & Gavilanes, F. (2006). Membrane-perturbing properties of three peptides corresponding to the ectodomain of hepatitis C virus E2 envelope protein. Biochim Biophys Acta 1758, 755763.[Medline]
Perez-Berna, A. J., Moreno, M. R., Guillen, J., Bernabeu, A. & Villalain, J. (2006). The membrane-active regions of the hepatitis C virus E1 and E2 envelope glycoproteins. Biochemistry 45, 37553768.[CrossRef][Medline]
Rey, F. A., Heinz, F. X., Mandl, C., Kunz, C. & Harrison, S. C. (1995). The envelope glycoprotein from tick-borne encephalitis virus at 2 Å resolution. Nature 375, 291298.[CrossRef][Medline]
Skehel, J. J. & Wiley, D. C. (2000). Receptor binding and membrane fusion in virus entry: the influenza hemagglutinin. Annu Rev Biochem 69, 531569.[CrossRef][Medline]
Stiasny, K. & Heinz, F. X. (2006). Flavivirus membrane fusion. J Gen Virol 87, 27552766.
Tscherne, D. M., Jones, C. T., Evans, M. J., Lindenbach, B. D., McKeating, J. A. & Rice, C. M. (2006). Time- and temperature-dependent activation of hepatitis C virus for low-pH-triggered entry. J Virol 80, 17341741.
Yagnik, A. T., Lahm, A., Meola, A., Roccasecca, R. M., Ercole, B. B., Nicosia, A. & Tramontano, A. (2000). A model for the hepatitis C virus envelope glycoprotein E2. Proteins 40, 355366.[CrossRef][Medline]
Received 13 September 2006;
accepted 4 December 2006.
This article has been cited by other articles:
![]() |
T. Phan, R. K. F. Beran, C. Peters, I. C. Lorenz, and B. D. Lindenbach Hepatitis C Virus NS2 Protein Contributes to Virus Particle Assembly via Opposing Epistatic Interactions with the E1-E2 Glycoprotein and NS3-NS4A Enzyme Complexes J. Virol., September 1, 2009; 83(17): 8379 - 8395. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Haid, T. Pietschmann, and E.-I. Pecheur Low pH-dependent Hepatitis C Virus Membrane Fusion Depends on E2 Integrity, Target Lipid Composition, and Density of Virus Particles J. Biol. Chem., June 26, 2009; 284(26): 17657 - 17667. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. McCaffrey, I. Boo, P. Poumbourios, and H. E. Drummer Expression and Characterization of a Minimal Hepatitis C Virus Glycoprotein E2 Core Domain That Retains CD81 Binding J. Virol., September 1, 2007; 81(17): 9584 - 9590. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| INT J SYST EVOL MICROBIOL | MICROBIOLOGY | J GEN VIROL |
| J MED MICROBIOL | ALL SGM JOURNALS | |