|
|
||||||||
1 Enterovirus Laboratory, National Public Health Institute, Helsinki, Finland
2 Renal Transplant Unit, Helsinki University Hospital, Helsinki, Finland
3 Institute of Poliomyelitis and Viral Encephalitis, Russian Academy of Medical Sciences, Moscow, Russia
4 Department of Virology, Slovak Medical University, Bratislava, Slovak Republic
Correspondence
Merja Roivainen
merja.roivainen{at}ktl.fi
| ABSTRACT |
|---|
|
|
|---|
The GenBank/EMBL/DDBJ sequence accession number for the sequence reported in this paper is EF634316.
Supplementary Tables are available with the online version of this paper.
| INTRODUCTION |
|---|
|
|
|---|
EV exhibit a wide range of acute clinical manifestations including meningitis, encephalitis and paralysis, but also those of milder symptoms like common cold, eye infections, acute otitis media and skin disease. Infections of this virus group are also known to cause acute and chronic myocarditis in humans. More recently, infections caused by EV have been associated to atherosclerotic disease, myocardial infarction (Reunanen et al., 2002
, 2005
; Roivainen et al., 1998a
, 1999
), type 1 diabetes (T1D; Andreoletti et al., 1997
; Clements et al., 1995
; Hyoty et al., 1995
; Roivainen et al., 1998b
) and also to bronchiolitis and asthma (Jartti et al., 2004
).
The EV serotypes associated with pathogenesis of T1D have been assessed by cross-sectional and prospective studies on patients with T1D and/or prediabetic individuals. For the time being, there is no evidence suggesting that only certain EV serotypes should be considered potentially diabetogenic and it is also possible that viral features other than phenotypic properties of the capsid would have a key role in the process. Attempts have been made to identify viral determinants responsible for diabetogenic properties through full-genome sequencing of selected virus strains, but the critical determinants remain to be discovered (Al-Hello et al., 2005
; Kang et al., 1994
; Paananen et al., 2003
; Titchener et al., 1994
; Williams et al., 2006
).
Traditionally, identification of EV infections has been based on virus isolation in cell culture followed by neutralization typing by monotypic antiserum pools. The method is highly specific. Although polyclonal antiserum contains antibodies to several different epitopes, and some of them might be cross-reactive in binding assays among related virus serotypes, they do not confuse the results of neutralization. In the assay only virus strains belonging to the serotype used as an immunogen in the antibody production could be neutralized. Therefore, the dual neutralization of the virus is usually considered as a technical error. More recently, molecular methods for identification of the serotype of an EV isolate have been developed (Oberste et al., 1999
) which have changed the laboratory diagnosis of EV infections considerably.
In this study, a virus strain isolated from a diabetic child and originally serotyped as CAV-9 was studied for β-cell tropism and cloned for molecular characterization. However, based on whole-genome sequence, the isolate turned out to be echovirus 11 (E-11). Phylogenetic analyses demonstrated that this strain was closely related to a specific subgroup of E-11 strains known to cause uveitis. Neutralization studies with CAV-9- and E-11-specific antisera demonstrated that these genetically related virus strains were exceptional, since they were neutralized by both CAV-9- and E-11-specific antisera. Antigenic regions of the isolate as well as viral epitopes responsible for cross-reactivity with CAV-9 were identified by peptide scanning technique.
| METHODS |
|---|
|
|
|---|
Strains E-11/Kust/86, E-11/Kar/87 and E11/Kh3/97 were provided by A.N. Lukashev (Lukashev et al., 2002
, 2003
). The first two strains were causative agents of uveitis outbreaks in Siberia in 1986 and 1987, while the third virus was an occasional isolate in the Russian Far East in 1997.
Antiserum pools and monotypic sera.
EV-specific neutralizing antiserum pools and monotypic polyclonal rabbit antisera, which were used originally for isolate typing, were obtained as a gift from the Russian Academy of Medical Sciences, Moscow.
Plaque neutralization assay.
Pretitrated virus (approx. 100 p.f.u.) was incubated (1 h at 36 °C, then overnight at room temperature) with equal volume of virus-specific polyclonal antiserum from hyperimmunized rabbits. The preneutralized virus samples were quantified for infectious live virus by administration onto GMK cell monolayers (six-well plates). The plates were incubated for 30 min at 36 °C in the presence of 5 % CO2 and overlaid by 2 ml of 0.5 % carboxy methyl cellulose in culture medium. The amount of plaques was counted after 2 days incubation at 36 °C in the presence of 5 % CO2.
Purification of RNA.
Total RNA was extracted from cells infected with E-11 D207 using TRIzol Reagent (Gibco-BRL) according to the manufacturer's instructions.
cDNA synthesis.
cDNA was synthesized from purified RNA using a SuperScript First-Strand Synthesis System for RT-PCR kit (Invitrogen) according to the manufacturer's instructions. The reverse primer A83A (5'-CCGCGGCCGCTTTTTTTTTTTTTTTTTTTTTTTTCCTCCGCACCGAATGCGGAGAATTTACCCCTACTGC-3') was used in the reaction.
Synthesis of full-length PCR product.
The full-length PCR product was synthesized using a SuperScript One-Step RT-PCR for Long Templates kit (Invitrogen) according to the manufacturer's instructions. The sample was already cDNA so the cDNA synthesis step was omitted. The primers used were forward primer A82S (5'-GAGATCGATTAATACGACTCACTATAGGTTTAAAACAGCCTGTGGGTTGTTCCCACCC-3') and reverse primer A83A (see above).
Ligation and transformation.
Purified PCR product was ligated using pGEM-T Easy Vector System I kit (Promega) according to the manufacturer's instructions without a prior A-tailing step. The ligation reaction took place at 4 °C overnight. The ligated products were transformed into competent Escherichia coli DH5
cells.
Purification of plasmid DNA.
Plasmid DNA was isolated using QIAprep Spin Miniprep kit protocol (Qiagen). The dried pellet was then eluted. In order to select clones for further experiments, a small amount of the purified plasmid DNA was analysed for the presence of full-length inserts.
Transcription of RNA and transfection.
Clones, containing full-length inserts, were digested with the NotI restriction enzyme (New England Biolabs) and then transcribed into RNA using T7 polymerase (Roche) for 1 h at 37 °C. Transcribed RNA (5 and 20 µl) was transfected into sub-confluent GMK cells to determine their infectivity using Lipofectamine and Plus reagent (Invitrogen).
Sequencing.
The full-length infectious clone was sequenced using the primer walking strategy. Every nucleotide was sequenced at least twice. The cycle sequencing reactions were performed using a BigDye Terminator v1.1 Cycle Sequencing kit (Applied Biosystems). Automated sequencing equipment ABI Prism 310 Genetic Analyzer (Applied Biosystems) was used. Primers (Table S1) were purchased from DNA Technology A/S. The pUC/M13 Forward primer was purchased from Promega. Sequence data were analysed using Vector NTI Suite 6, assembled using ContigExpress and aligned using AlignX software.
Phylogenetic analysis.
The nucleotide and amino acid sequences were aligned by CLUSTAL_X 1.83 (Thompson et al., 1997
). Phylogenetic trees were produced by Bootstrap N-J Tree (CLUSTAL_X 1.83) using 1000 bootstrap replicates (bootstrap value 700 was considered significant) and were visualized with NJPlot (Perriere & Gouy, 1996
). Similarity analysis of complete genomes was performed with SimPlot 2.5 (Lole et al., 1999
) with a window of 200 nucleotides.
The following previously published complete EV sequences used in phylogenetic trees were obtained from GenBank: coxsackievirus A9 Griggs (CAV-9) (D00627 [GenBank] ), B1 coxsackievirus Japan (M16560 [GenBank] ), (CBV-1) Ohio (AF085363 [GenBank] ), CBV-3 Nancy (M33854 [GenBank] ), CBV-4 J.V.B. (X05690 [GenBank] ), CBV-5 Faulkner (AF114383 [GenBank] ), CBV-6 Schmitt (AF114384 [GenBank] ), echovirus 1 (E-1) Farouk (AF029859 [GenBank] ), E-2 Cornelis (AY302545 [GenBank] ), E-3 Morrisey (AY302553 [GenBank] ), E-3 PicoBank/DM1/E3 (AJ849942 [GenBank] ), E-4 Pesacek (AY302557 [GenBank] ), E-5 Noyce (AF083069 [GenBank] ), E-6 D'Amori (AY302558 [GenBank] ), E-7 Wallace (AY036579 [GenBank] ), E-9 Barty-INF (AF524866 [GenBank] ), E-9 DM (AF524867 [GenBank] ), E-11 Gregory (X80059 [GenBank] ), E-11 Hun/90 (AY167103 [GenBank] ), E-11 Kar/87 (AY167104 [GenBank] ), E-11 Kust/86 (AY167105 [GenBank] ), E-11 Mor/M/82 (AY167106 [GenBank] ), E-12 Travis (X79047 [GenBank] ), E-13 Del Carmen (AY302539 [GenBank] ), E-14 Tow (AY302540 [GenBank] ), E-15 Ch 96-51 (AY302541 [GenBank] ), E-16 Harrington (AY302542 [GenBank] ), E-17 CHHE-29 (AY302543 [GenBank] ), E-18 Metcalf (AF317694 [GenBank] ), E-19 Burke (AY302544 [GenBank] ), E-19 K/542/81 (AY167107 [GenBank] ), E-20 JV-1 (AY302546 [GenBank] ), E-21 Farina (AY302547 [GenBank] ), E-24 De Camp (AY302548 [GenBank] ), E-25 JV-4 (AY302549 [GenBank] ), E-26 Coronel (AY302550 [GenBank] ), E-27 Bacon (AY302551 [GenBank] ), E-29 JV-10 (AY302552 [GenBank] ), E-30 Bastianni (AF311938 [GenBank] ), E-30 14916net87 (DQ534205 [GenBank] ), E-31 Caldwell (AY302554 [GenBank] ), E-32 PR-10 (AY302555 [GenBank] ), E-33 Toluca-3 (AY302556 [GenBank] ), EV 69 Toluca-1 (AY302560 [GenBank] ) and EV 73 CA55-1988 (AF241359 [GenBank] ).
Virus-specific antisera.
E-11/D207- and CAV-9/Griggs-specific rabbit antisera were produced by hyperimmunizing rabbits with 3–4 doses of purified virus (20–30 µg per dose) in Freund's complete (the first dose) or incomplete adjuvants. Seven to ten days after the last booster, blood samples were drawn for serum. Rabbit antisera to strains E-11/MorM/82, E-11/Pah/89, E-11/Vlad/89, E-11/Kust/86 and E-11/Kar/87 were kindly provided by Dr G.A. Koroleva. More information on these strains can be found in Lukashev et al. (2002
, 2003
). E11-specific polyclonal antiserum used in plaque neutralization assay was purchased from Swedish Institute for Infectious Diseases Control, Solna, Sweden.
Peptide scanning.
Overlapping peptides spanning the capsid protein sequences of the E-11 isolate D207 were synthesized on polyethylene glycol derivatized cellulose membranes (Hartman Analytic) using a 12-amino-acid window and three-residue shift in a 384 spot format. Epitope mapping assay was performed basically as instructed by manufacturer (ABIMED and Genosys) and as described previously (Harkonen et al., 2002
, 2003
; Pulli et al., 1998
). Briefly, the peptide-coupled membranes were incubated at 4 °C overnight with blocking buffer [Tris-buffered saline (TBS), pH 8.0], containing 0.05 % Tween-20 (Fluka), 1 % casein (Genosys), and 5 % w/v sucrose. All subsequent steps were performed at room temperature. Membranes were incubated for 2 h with virus-specific hyperimmune rabbit serum, diluted in blocking buffer, washed 5x5 min with washing buffer and incubated with horseradish peroxidase (HRP)-conjugated anti-rabbit immunoglobulins (Bio-Rad; 1 : 1500) for 30 min. Membranes were washed as above and incubated for 1 min with chemiluminescence reagent plus (NEN Life Science Products). Chemiluminescence was counted with a Victor scintillation counter (PerkinElmer) and verified by autoradiography. The membranes were regenerated with 8 M urea, 1 % SDS/0.1 % β-mercaptoethanol (3x30 min at 50 °C), 5x10 min (room temperature) in 50 % ethanol/40 % water/10 % acetic acid and 5x5 min with TBS 0.05 % Tween. The success of regeneration was tested with incubation of the membranes with conjugate.
Human pancreatic islets.
Human pancreatic islets were isolated and purified at the Uppsala University Hospital (coordinator Professor Olle Korsgren) as previously described (Johansson et al., 2003
), with the consent of the ethics committee of Uppsala University. In Helsinki parallel aliquots of islets were infected with an apparent high multiplicity of isolate D207 or CAV-9 Griggs (Ylipaasto et al., 2005
).
Cell viability.
Viability of islets infected with isolate D207 or CAV-9 were measured using the live/dead cell fluorescence assay with fluorescent probes (Molecular Probes). Islets harvested at one week after treatments were incubated with the labelling solution for 30 min at room temperature in the dark and analysed with a confocal microscope (Leica TCS NT).
| RESULTS |
|---|
|
|
|---|
Molecular cloning and sequencing of the isolate; genetic identity E-11 rather than CAV-9
In order to characterize the D207 isolate at molecular level a full-length infectious clone was produced. Viral RNA extracted from plaque-purified virus-infected cells was converted into cDNA and used as a starting material for corresponding full-length PCR. Full-length PCR product was gel extracted and ligated into pGEM-T Easy vector. Full-length clone linearized with the NotI restriction enzyme was transcribed into RNA using T7 polymerase. Infectivity of the full-length RNA was documented by transfection experiments. Infectious clone was sequenced using the primer walking strategy.
The full-length genome comprised 7432 nt. The 5' non-coding region was 745 nt and the 3' non-coding region 106 nt. The single open reading frame was coding for a 2195 aa polyprotein. The comparison of capsid protein VP1 sequences between the isolate D207 and strains in GenBank revealed that the isolate D207 does not belong to CAV-9, but is E-11 (Table 1
). Comparison of different regions of the D207 genome with the prototype strains E-11 Gregory and CAV-9 Griggs indicates that D207 is closer to E-11 Gregory in capsid regions. In non-structural proteins 3A and 3B, D207 is more similar to E-11 whereas in 2A, 2C, 3C and 3D and also in both 3' and 5' non-coding regions it is more similar to CAV-9 Griggs (Table 1
). In order to analyse genetic relationships of isolate D207 with other E-11 strains, phylogenetic trees were constructed using different regions of the genome. All E-11 strains formed a monophyletic group in the capsid-encoding region (Fig. 1
). Within this group, the closest relatives of the D207 isolate were E-11 strains that were isolated from infants with severe EV infections in 1986–1990. These strains were designated E-11/B group due to their marked serological difference from the prototype E-11 strain Gregory (Lukashev et al., 2002
). Strains E-11/Kust/86 and E-11/Kar/87 were isolated from infants with uveitis, while strain E-11/Hun/90 was isolated during an outbreak of severe multisystem disease (MSD) of newborns in Hungary (el-Sageyer et al., 1998
). We can therefore conclude that isolate D207 belongs phylogenetically to the E-11/B subtype. In the non-structural region, all E-11 strains did not cluster together (Fig. 1
), but the relationship of D207 to the uveitis-causing strains E-11/Kust/86, E-11/Kar/87 and MSD-causing strain E-11/Hun/90 still held true. Likewise, in the 5' non-coding region the strains showed similarity of 90 % or more to D207.
|
|
The D207 isolate of E-11 is neutralized with polyclonal CAV-9-specific antiserum, but also with E-11-specific antiserum
Neutralization of E-11 isolate (D207) was studied further by plaque-neutralization assay with polyclonal antisera to E-11 and CAV-9 (Hovi & Roivainen, 1993
). In parallel with the original isolate (D207), the first passage of the same isolate and the virus strain produced from the infectious clone constructed in the study (Lipo-D207) were analysed. Prototype strains of CAV-9 and E-11 were used as positive controls. As shown in Table 2(a)
, the prototype strains were only neutralized with their own virus-specific antiserum, whereas all three parallel strains of the isolate D207 were neutralized with E-11-specific antiserum (reduction of infectivity about 3 logs) and with CAV-9-specific antiserum (reduction of infectivity about 2–3 logs).
|
Neutralization properties of isolate E-11/D207 are shared with uveitis-causing strains of E-11
As shown by phylogenetic analysis, the uveitis-causing strains of E-11/B subtype were the closest relatives of isolate D207. Next, it was studied whether the capability of the virus to be neutralized with CAV-9-specific antiserum goes together with the phylogenetic relationship. When two E-11 strains known to cause uveitis (Kust/86 and Kar/87) and one strain that was almost incapable of inducing uveitis in monkeys, E-11/Kh3/97, were tested for neutralization, we found that two of them were neutralized with CAV-9 antiserum whereas one was not (Table 2c
). Interestingly, both neutralized virus strains were those uveitis-causing strains of E-11/B subtype.
When polyclonal rabbit antisera produced against six uveitis-causing E-11 strains were analysed for neutralization with D207 isolate, we found that the isolate was neutralized efficiently by all of them (Fig. 2
). The infectivity of D207 was completely blocked by antisera raised against the uveitis-causing E-11 strains E-11/Kust/86, E-11/Kar/87 and E-11/Pah/89, and against MSD-causing strains E-11/Vlad/88 and E-11/Hun/90 (infectivity reduced by more than 6 logs). All these strains were previously shown to belong to E-11/B subtype (Lukashev et al., 2002
, 2003
). Meanwhile, the infectivity of isolate D207 was reduced by only 3 logs with the antiserum to E-11/Mor/M/82, which caused uveitis, but did not belong to E-11/B subtype. This same neutralization pattern was seen with other highly uveitic E-11 strains, E-11/Kar/87 and E-11/Kust/86. In contrast, neutralization profiles of the E-11 prototype strain Gregory and the less pathogenic strain E-11/Kh3/97 (Lukashev et al., 2003
) were more restricted, since neither of them were properly neutralized with antisera to E-11/Pah/89 and E-11/Mor/M/82. Interestingly, all E-11/B strains and prototype strain Gregory studied were neutralized completely with a polyclonal rabbit antiserum to E-11/D207. Altogether, our results suggest that E-11/D207 shares antigenic properties with both E-11/B strains causing severe infant infections, and with CAV-9.
|
|
|
| DISCUSSION |
|---|
|
|
|---|
The D207 strain was subjected to detailed studies firstly, because it was isolated from a diabetic patient and secondly, because it initially appeared to be an aberrantly behaving CAV-9 strain. Primary human islets in culture have been widely used in studies where diabetogenic determinants of EV have been of interest and human β-cells have been shown to be highly sensitive to different EV serotypes. However, the consequences of virus replication on β-cell survival and β-cell specific function have been strongly dependent on the virus strain (Roivainen et al., 2000
, 2002
). For example, the prototype strain of CAV-9 caused only subtle morphological changes sometimes associated with impaired functional properties of insulin-producing β-cells (Roivainen et al., 2000
). When the D207 isolate, initially identified as CAV-9, was studied for β-cell tropism in primary human islets, a rapid cytolysis coinciding with severe functional damage of the surviving cells was evident. This finding prompted us to clone the isolate for full-length genome sequencing and molecular characterization. Surprisingly, based on the whole-genome sequence, the isolate turned out to be E-11. Phylogenetic analyses of E-11/D207 revealed that it was closely related in the capsid-encoding region to a specific subgroup of E-11 strains, previously designated E-11/B, known to cause severe infant infections, uveitis and MSD (Lukashev et al., 2003
). This suggests that the capsid-encoding regions of D207 strain and the uveitis associated E-11/B strains have a common evolutionary history and have diverged from the rest of E-11 strains long ago. The potential genetic counterpart of the uveitis association of E-11/B strains has not been identified, and with the current knowledge we cannot say anything about putative pathogenic role of the D207 in the diabetes of the patient from whom the virus was isolated.
In contrast with the capsid-coding region, the non-structural region of isolate D207 was significantly different from the uveitis- and MSD-causing E-11/B strains. This suggests that the ancestors of the isolate acquired the non-structural part of the genome by recombination with some other HEV-B virus, as suggested previously (Chevaliez et al., 2004
; Lukashev et al., 2004
). It is possible that a somewhat closer relationship of isolate D207 to uveitis-causing strains in this part of the genome is explained by an overall elevated similarity of most modern HEV-B strains in the non-structural genome region (Lukashev et al., 2003
).
Virus strains neutralized by two evidently monotypic EV antisera are extremely rare. In diagnostic laboratories carrying out EV serotyping by neutralization assay, a result suggesting double reactivity is primarily interpreted as a technical error. Careful retyping of the strain usually clarifies the situation. Primary serotyping of the D207 strain did not suggest double reactivity, which might be due to relative potencies of the E-11 and CAV-9 antibodies in the intersecting pools used. Double reactivity was revealed only in more detailed studies started after the surprising result of sequence-based identification. By neutralization experiments with polyclonal antisera raised against CAV-9 and E-11, respectively, it was demonstrated that neutralization of E-11/D207 with both antisera is a real characteristic of this virus strain. Further experiments on a collection of E-11 strains known to cause uveitis to a variable extent confirmed the idea that genetically related highly virulent strains, E-11/B isolates Kar/87, Kust/86 and Hun/90, are also neutralized with both antisera. While low degree cross-reactions between certain EV serotypes, when assayed with monotypic hyperimmune animal antisera, are known to exist even in neutralization assays, we are not aware of previous reports of this strong reaction, except in cases such as E-1 and 8, CAVs 11 and 13, and CAVs 15 and 18, which are now pairwise considered single serotypes, respectively. Our results therefore suggest that the serotype evolutionary space is not infinite and changes in the virus capsid can lead to apparent convergence of virus serological properties.
One could speculate that an E-11/CAV-9 recombination with the joining point within the capsid coding region could have resulted in the observed hybrid reactivity. However, neither visual nor computer-assisted SimPlot analysis of the capsid protein sequences gave support to this view. This is also in agreement with the observation that the antiserum raised against D207 strain did not neutralize CAV-9. Only sporadic amino acids distributed throughout the four capsid proteins showed identity between D207, most of the uveitis-associated strains and CAV-9 while differing from the E-11 prototype strain Gregory. On the other hand, an antiserum to CAV-9 was able to recognize distinct peptides synthesized according to the sequence of E-11/D207. Some of the reacting regions coincided with those reacting with an antiserum against the D207 strain. The amino acid sequences of some of these regions differed remarkably between the two virus strains and the above sporadic shared amino acids did not by any means concentrate in these regions. The three-dimensional atomic model of a protomer, based on the X-ray crystallographic analysis of E-11 (Stuart et al., 2002
), revealed that at least some of the regions recognized by CAV-9 are located on the outer surface of the virion, suggesting that they could be candidates for neutralization epitopes specifically recognized by CAV-9-induced antiserum. Interestingly, the CAV-9-specific antiserum, but not the D207-specific antiserum, recognized peptides covering the sequence EILNYYAHWSGSVKLTFVFCGSAMATGKFLLAY from the capsid protein VP3. This region in E-11/D207 includes the 13 aa sequence which was found in Simplot analyses to be different from E-11 Gregory, but similar with that of CAV-9.
It is generally accepted that most of the known neutralizing antigenic sites in EV are conformational, while at least some of them can also be detected with peptide scanning reflecting binding of antibodies to linear sequences (Roivainen et al., 1991
). The latter method may, in addition, detect linear capsid protein sequences capable of binding serum antibodies not relevant to virus neutralization. It is also known that properties of homologous animal hyperimmune sera may vary depending on the immunization procedure and the immunized animal. However, in this case the aberrant result seems to be a true property of the E-11 strains, as independent preparations of CAV-9 antisera gave a similar result (not shown). The D207 strain and several strains of E-11/B subtype isolated geographically in relatively distant locations shared this double serotype specificity and also showed monophyletic origin in most genomic regions, suggesting that the acquirement of additional CAV-9 specificity has occurred for a specific E-11 lineage only once in the past.
In conclusion, we have shown in this paper that an EV strain isolated from a diabetic child belongs to genetic subcluster B of E-11, but is also neutralized with monotypic antisera to CAV-9. The dual serological specificity turned out to be a common property among the strains of this genetic subcluster, since other genetically closely related virus strains studied were also neutralized by both E-11- and CAV-9-induced polyclonal antisera. Simplot and peptide scanning analyses carried out did not reveal a simple explanation for this dual specificity. Epitopes responsible for this feature remain unidentified.
| ACKNOWLEDGEMENTS |
|---|
| REFERENCES |
|---|
|
|
|---|
Andreoletti, L., Hober, D., Hober-Vandenberghe, C., Belaich, S., Vantyghem, M.-C., Lefebvre, J. & Wattre, P. (1997). Detection of coxsackie B virus RNA sequences in whole blood samples from adult patients at the onset of type I diabetes mellitus. J Med Virol 52, 121–127.[CrossRef][Medline]
Chevaliez, S., Szendroi, A., Caro, V., Balanant, J., Guillot, S., Berencsi, G. & Delpeyroux, F. (2004). Molecular comparison of echovirus 11 strains circulating in Europe during an epidemic of multisystem hemorrhagic disease of infants indicates that evolution generally occurs by recombination. Virology 325, 56–70.[CrossRef][Medline]
Clements, G. B., Galbraith, D. N. & Taylor, K. W. (1995). Coxsackie B virus infection and onset of childhood diabetes. Lancet 346, 221–223.[CrossRef][Medline]
el-Sageyer, M. M., Szendroi, A., Hutter, E., Uj, M., Szucs, G., Mezey, I., Toth, I., Katai, A., Kapiller, Z., Pall, G. & other authors (1998). Characterisation of an echovirus type 11' (prime) epidemic strain causing haemorrhagic syndrome in newborn babies in Hungary. Acta Virol 42, 157–166.[Medline]
Harkonen, T., Lankinen, H., Davydova, B., Hovi, T. & Roivainen, M. (2002). Enterovirus infection can induce immune responses that cross-react with β-cell autoantigen tyrosine phosphatase IA-2/IAR. J Med Virol 66, 340–350.[CrossRef][Medline]
Harkonen, T., Paananen, A., Lankinen, H., Hovi, T., Vaarala, O. & Roivainen, M. (2003). Enterovirus infection may induce humoral immune response reacting with islet cell autoantigens in humans. J Med Virol 69, 426–440.[CrossRef][Medline]
Hovi, T. & Roivainen, M. (1993). Peptide antisera targeted to a conserved sequence in poliovirus capsid VP1 cross-react widely with members of the genus Enterovirus. J Clin Microbiol 31, 1083–1087.
Hyoty, H., Hiltunen, M., Knip, M., Laakkonen, M., Vahasalo, P., Karjalainen, J., Koskela, P., Roivainen, M., Leinikki, P. & other authors (1995). A prospective study of the role of coxsackie B and other enterovirus infections in the pathogenesis of IDDM. Childhood Diabetes in Finland (DiMe) Study Group. Diabetes 44, 652–657.[Abstract]
Jartti, T., Lehtinen, P., Vuorinen, T., Koskenvuo, M. & Ruuskanen, O. (2004). Persistence of rhinovirus and enterovirus RNA after acute respiratory illness in children. J Med Virol 72, 695–699.[CrossRef][Medline]
Johansson, U., Olsson, A., Gabrielsson, S., Nilsson, B. & Korsgren, O. (2003). Inflammatory mediators expressed in human islets of Langerhans: implications for islet transplantation. Biochem Biophys Res Commun 308, 474–479.[CrossRef][Medline]
Kang, Y., Chatterjee, N. K., Nodwell, M. J. & Yoon, J. W. (1994). Complete nucleotide sequence of a strain of coxsackie B4 virus of human origin that induces diabetes in mice and its comparison with nondiabetogenic coxsackie B4 JBV strain. J Med Virol 44, 353–361.[Medline]
Lole, K. S., Bollinger, R. C., Paranjape, R. S., Gadkari, D., Kulkarni, S. S., Novak, N. G., Ingersoll, R., Sheppard, H. W. & Ray, S. C. (1999). Full-length human immunodeficiency virus type 1 genomes from subtype C-infected seroconverters in India, with evidence of intersubtype recombination. J Virol 73, 152–160.
Lukashev, A. N., Lashkevich, V. A., Koroleva, G. A. & Karganova, G. G. (2002). Phylogenetic and serological characterization of echovirus 11 and echovirus 19 strains causing uveitis. Arch Virol 147, 131–142.[CrossRef][Medline]
Lukashev, A. N., Lashkevich, V. A., Koroleva, G. A., Ilonen, J., Karganova, G. G., Reznik, V. I. & Hinkkanen, A. E. (2003). Molecular epidemiology of enteroviruses causing uveitis and multisystem hemorrhagic disease of infants. Virology 307, 45–53.[CrossRef][Medline]
Lukashev, A. N., Lashkevich, V. A., Koroleva, G. A., Ilonen, J. & Hinkkanen, A. E. (2004). Recombination in uveitis-causing enterovirus strains. J Gen Virol 85, 463–470.
Oberste, M. S., Maher, K., Kilpatrick, D. R., Flemister, M. R., Brown, B. A. & Pallansch, M. A. (1999). Typing of human enteroviruses by partial sequencing of VP1. J Clin Microbiol 37, 1288–1293.
Paananen, A., Ylipaasto, P., Rieder, E., Hovi, T., Galama, J. & Roivainen, M. (2003). Molecular and biological analysis of echovirus 9 strain isolated from a diabetic child. J Med Virol 69, 529–537.[CrossRef][Medline]
Perriere, G. & Gouy, M. (1996). WWW-query: an on-line retrieval system for biological sequence banks. Biochimie 78, 364–369.[Medline]
Pulli, T., Lankinen, H., Roivainen, M. & Hyypia, T. (1998). Antigenic sites of coxsackievirus A9. Virology 240, 202–212.[CrossRef][Medline]
Reunanen, A., Roivainen, M., Kleemola, M., Saikku, P., Leinonen, M., Hovi, T., Knekt, P., Leino, A. & Aromaa, A. (2002). Enterovirus, mycoplasma and other infections as predictors for myocardial infarction. J Intern Med 252, 421–429.[CrossRef][Medline]
Reunanen, A., Roivainen, M. & Kleemola, M. (2005). Increased titer of antibodies to Mycoplasma pneumoniae may be associated with coronary heart disease. Atherosclerosis 180, 209–210.[Medline]
Roivainen, M. (1999). Enteroviruses and myocardial infarction. Am Heart J 138, S479–S483.[CrossRef][Medline]
Roivainen, M., Narvanen, A., Korkolainen, M., Huhtala, M. L. & Hovi, T. (1991). Antigenic regions of poliovirus type 3/Sabin capsid proteins recognized by human sera in the peptide scanning technique. Virology 180, 99–107.[CrossRef][Medline]
Roivainen, M., Alfthan, G., Jousilahti, P., Kimpimaki, M., Hovi, T. & Tuomilehto, J. (1998a). Enterovirus infections as a possible risk factor for myocardial infarction. Circulation 98, 2534–2537.
Roivainen, M., Knip, M., Hyoty, H., Kulmala, P., Hiltunen, M., Vahasalo, P., Hovi, T. & Akerblom, H. K. (1998b). Several different enterovirus serotypes can be associated with prediabetic autoimmune episodes and onset of overt IDDM. Childhood Diabetes in Finland (DiMe) Study Group. J Med Virol 56, 74–78.[CrossRef][Medline]
Roivainen, M., Rasilainen, S., Ylipaasto, P., Nissinen, R., Ustinov, J., Bouwens, L., Eizirik, D. L., Hovi, T. & Otonkoski, T. (2000). Mechanisms of coxsackievirus-induced damage to human pancreatic beta- cells. J Clin Endocrinol Metab 85, 432–440.
Roivainen, M., Ylipaasto, P., Savolainen, C., Galama, J., Hovi, T. & Otonkoski, T. (2002). Functional impairment and killing of human beta cells by enteroviruses: the capacity is shared by a wide range of serotypes, but the extent is a characteristic of individual virus strains. Diabetologia 45, 693–702.[CrossRef][Medline]
Stuart, A. D., McKee, T., Williams, P., Harley, C., Shen, S., Stuart, D., Brown, T. & Lea, S. (2002). Determination of the structure of a decay accelerating factor-binding clinical isolate of echovirus 11 allows mapping of mutants with altered receptor requirements for infection. J Virol 76, 7694–7704.
Thompson, J. D., Gibson, T. J., Plewniak, F., Jeanmougin, F. & Higgins, D. G. (1997). The CLUSTAL_X windows interface: flexible strategies for multiple sequence alignment aided by quality analysis tools. Nucleic Acids Res 25, 4876–4882.
Titchener, P. A., Jenkins, O., Szopa, T. M., Taylor, K. W. & Almond, J. W. (1994). Complete nucleotide sequence of a beta-cell tropic variant of coxsackievirus B4. J Med Virol 42, 369–373.[Medline]
Williams, C. H., Oikarinen, S., Tauriainen, S., Salminen, K., Hyoty, H. & Stanway, G. (2006). Molecular analysis of an echovirus 3 strain isolated from an individual concurrently with appearance of islet cell and IA-2 autoantibodies. J Clin Microbiol 44, 441–448.
Ylipaasto, P., Kutlu, B., Rasilainen, S., Rasschaert, J., Salmela, K., Teerijoki, H., Korsgren, O., Lahesmaa, R., Hovi, T. & other authors (2005). Global profiling of coxsackievirus- and cytokine-induced gene expression in human pancreatic islets. Diabetologia 48, 1510–1522.[CrossRef][Medline]
Received 24 September 2007;
accepted 25 March 2008.
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| INT J SYST EVOL MICROBIOL | MICROBIOLOGY | J GEN VIROL |
| J MED MICROBIOL | ALL SGM JOURNALS | |